PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0213s0330.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 555aa    MW: 61761.9 Da    PI: 4.493
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0213s0330.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.1e-52101371128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             l+pGfrFhPtdeelv +yLk+kv++k+++l ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky +g ++nrat++gyWk+
  SapurV1A.0213s0330.2.p  10 LAPGFRFHPTDEELVRYYLKRKVTNKPFRL-DAISVTDVYKSEPWDLPvKsKLKSRDLEWYFFSMLDKKYGNGAKTNRATEKGYWKT 95 
                             579***************************.99***************5347777777***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++v+  ++++vg+kktLv+++grap+ge+++Wvmheyrl
  SapurV1A.0213s0330.2.p  96 TGKDRPVHW-NSRVVGMKKTLVYHQGRAPRGERSNWVMHEYRL 137
                             ********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-608160IPR003441NAC domain
PROSITE profilePS5100557.24410160IPR003441NAC domain
PfamPF023651.1E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MGSSDSATSL APGFRFHPTD EELVRYYLKR KVTNKPFRLD AISVTDVYKS EPWDLPVKSK  60
LKSRDLEWYF FSMLDKKYGN GAKTNRATEK GYWKTTGKDR PVHWNSRVVG MKKTLVYHQG  120
RAPRGERSNW VMHEYRLVDE ELEKAGIAQD AFVLCRIFQK SGTGPKNGEQ YGAPFIEEEW  180
EDDEVPLLPS EEMVPTGEAP AGDGSYLELN ELDQNFDSGI TSENTALPLN FYYGETSNYV  240
EHPSNFSDDI KPVIRGVENR YGPAPPADQN MDLPGQYDVD ADKKEHIAEP INSVNAVGAN  300
YLFDESYLDA LDDLPQSEGF FLEANELSKP VDPETVAASS GFDMLEDYLN FFEAVNENMS  360
FDPSDIFGRE TAVSDQQLPP QEDVKGQTEE MSEASQNLSE IHGTIDPSSS KQKPEALKFD  420
SDVKNSFIKQ ASHRLGNIPA PPAFASEFPS KDAVLRLHPA SSSSINVTAG MIRIENMSLG  480
GNGMEWSFGK NGNVNIILSF GLPQQGGPDC LVPMNSLFRG KTESVVSRGW LYLIFFWVLV  540
LSVSYKIGTS ICAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-44616613171NAC domain-containing protein 19
4dul_A5e-44616613171NAC domain-containing protein 19
1ut7_B5e-44616613171NO APICAL MERISTEM PROTEIN
1ut7_A5e-44616613171NO APICAL MERISTEM PROTEIN
1ut4_B5e-44616613171NO APICAL MERISTEM PROTEIN
1ut4_A5e-44616613171NO APICAL MERISTEM PROTEIN
3swp_D7e-44616616174NAC domain-containing protein 19
3swp_C7e-44616616174NAC domain-containing protein 19
3swp_B7e-44616616174NAC domain-containing protein 19
3swp_A7e-44616616174NAC domain-containing protein 19
3swm_D7e-44616616174NAC domain-containing protein 19
3swm_C7e-44616616174NAC domain-containing protein 19
3swm_B7e-44616616174NAC domain-containing protein 19
3swm_A7e-44616616174NAC domain-containing protein 19
3ulx_A7e-4441609168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2246300.0CU224630.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006378789.10.0NAC domain-containing protein 78
SwissprotQ84K001e-170NAC78_ARATH; NAC domain-containing protein 78
TrEMBLU5G2X90.0U5G2X9_POPTR; NAC domain-containing protein 78
STRINGPOPTR_0010s23650.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-164NAC domain containing protein 2